Artificial Biosystem for Modulation of Interactions between Antigen-Presenting Cells and T Cells

oxfordpcs

Biosystems Design by Machine Studying

 

Biosystems akin to enzymes, pathways, and complete cells have been more and more explored for biotechnological purposes.

  • Nonetheless, the intricate connectivity and ensuing complexity of biosystems poses a serious hurdle in designing biosystems with fascinating options.
  • As -omics and different excessive throughput applied sciences have been quickly developed, the promise of making use of machine studying (ML) strategies in biosystems design has began to turn into a actuality.
  • ML fashions allow the identification of patterns inside sophisticated organic knowledge throughout a number of scales of study and might increase biosystems design purposes by predicting new candidates for optimized efficiency.
  • ML is getting used at each stage of biosystems design to assist discover nonobvious engineering options with fewer design iterations. On this overview, we first describe generally used fashions and modeling paradigms inside ML.
  • We then focus on some purposes of those fashions which have already proven success in biotechnological purposes.
  • Furthermore, we focus on successful purposes in any respect scales of biosystems design, together with nucleic acids, genetic circuits, proteins, pathways, genomes, and bioprocesses.
  • Lastly, we focus on some limitations of those strategies and potential options in addition to prospects of the mix of ML and biosystems design.

Dkk-1 Polyclonal Antibody

ES4292-50ul 50ul
EUR 207
Description: A Rabbit Polyclonal antibody against Dkk-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Dkk-1 Polyclonal Antibody

ABP53293-003ml 0.03ml
EUR 158
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

Dkk-1 Polyclonal Antibody

ABP53293-01ml 0.1ml
EUR 289
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

Dkk-1 Polyclonal Antibody

ABP53293-02ml 0.2ml
EUR 414
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

Anti-Dkk-1 antibody

STJ97257 200 µl
EUR 197
Description: Rabbit polyclonal to Dkk-1.

Anti-Dkk-1 antibody

STJ98000 100 µl
EUR 234
Description: Mouse monoclonal to Dkk-1.

Dkk-1 Polyclonal Antibody

41928-50ul 50ul
EUR 187

Dkk-1 Polyclonal Antibody

41928-100ul 100ul
EUR 252

Human CellExp? DKK-1, Human Recombinant

7132-10
EUR 278

Human CellExp? DKK-1, Human Recombinant

7132-50
EUR 1132

Dkk-2

GT15222 100 ug
EUR 526

Human DKK-1 PicoKine ELISA Kit

EK0867 96 wells
EUR 425
Description: For quantitative detection of human DKK1 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).

ELISA kit for Human DKK-1

EK5390 96 tests
EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Human DKK-1 in samples from serum, plasma, tissue homogenates and other biological fluids.

DKK-1 (CHO-expressed), Mouse

HY-P7154 50ug
EUR 762

Recombinant Mouse Dkk-1 Protein

RP01062 5 μg
EUR 183

Dkk-1 Polyclonal Conjugated Antibody

C41928 100ul
EUR 397

Human DKK-1 ELISA kit (4×96T)

LF-EK50798 4×96T
EUR 2201

Dkk-3 antibody

22898-100ul 100ul
EUR 390

DKK-3 ELISA KIT|Human

EF000091 96 Tests
EUR 689

Recombinant Human Dkk-3 Protein

RP00355 10 μg
EUR 164

ELISA kit for Rat DKK-1

EK5668 96 tests
EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Rat DKK-1 in samples from serum, plasma, tissue homogenates and other biological fluids.

Human DKK-1(Dickkopf-related protein 1) ELISA Kit

EH0113 96T
EUR 524.1
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 18.75pg/ml

Dkk-1 ELISA Kit (Human) : 96 Wells (OKAG00221)

OKAG00221 96 Wells
EUR 596
Description: Description of target: This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.;Species reactivity: Human;Application: ELISA;Assay info: Quantitative Colorimentric Sandwich ELISA;Sensitivity: 63 pg/mL

Dkk-3 Polyclonal Antibody

ES5541-50ul 50ul
EUR 207
Description: A Rabbit Polyclonal antibody against Dkk-3 from Human/Mouse. This antibody is tested and validated for WB, ELISA, WB, ELISA

Dkk-3 Polyclonal Antibody

ES5541-100ul 100ul
EUR 279
Description: A Rabbit Polyclonal antibody against Dkk-3 from Human/Mouse. This antibody is tested and validated for WB, ELISA, WB, ELISA

Dkk-3 Polyclonal Antibody

ABP54542-003ml 0.03ml
EUR 158
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

Dkk-3 Polyclonal Antibody

ABP54542-01ml 0.1ml
EUR 289
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

Dkk-3 Polyclonal Antibody

ABP54542-02ml 0.2ml
EUR 414
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

Anti-Dkk-3 antibody

STJ92720 200 µl
EUR 197
Description: Rabbit polyclonal to Dkk-3.

Anti-Dkk-3 antibody

STJ98001 100 µl
EUR 234
Description: Mouse monoclonal to Dkk-3.

Human DKK-4 PicoKine ELISA Kit

EK0868 96 wells
EUR 455
Description: For Quantitative Detection of human DKK-4 in cell culture supernates, serum and plasma(heparin, EDTA).

Recombinant Human Dkk-3/DKK3 Protein

RP00209 10 μg
EUR 155

DKK-3 ELISA Kit (Human) (OKBB00603)

OKBB00603 96 Wells
EUR 505
Description: Description of target: Dickkopf-related protein 3 is a protein that in humans is encoded by the DKK3 gene. This gene encodes a protein that is a member of the dickkopf family. It is mapped to 11p15.3. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Members of the Dkk-related family display unique patterns of mRNA expression in human and mouse tissues, and are secreted when expressed in 293T cells. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.;Species reactivity: Human;Application: ELISA;Assay info: Assay Methodology: Quantitative Sandwich Immunoassay;Sensitivity: <= 10 pg/mL

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc]

VAng-1451Lsx-100g 100 µg
EUR 848
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc]

VAng-1451Lsx-1mg 1 mg
EUR 4724
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [His]

VAng-1453Lsx-100g 100 µg
EUR 1013
Description: Human Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [His]

VAng-1453Lsx-1mg 1 mg
EUR 4999
Description: Human Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]

VAng-1454Lsx-1mg 1 mg
EUR 6374
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]

VAng-1454Lsx-250g 250 µg
EUR 2470
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]

VAng-1454Lsx-25g 25 µg
EUR 765
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 272) [His]

VAng-1455Lsx-500g 500 µg
EUR 4449
Description: Mouse Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: O54908)

Recombinant Dkk-1 Protein (Thr 32-His 272) [His]

VAng-1455Lsx-50g 50 µg
EUR 1013
Description: Mouse Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: O54908)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc] [Avi]

VAng-1452Lsx-200g 200 µg
EUR 3844
Description: Biotinylated Human Dkk-1, Fc tag and Avi tag, is expressed in HEK 293 cells. (Uniprot ID: O94907-1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc] [Avi]

VAng-1452Lsx-25g 25 µg
EUR 1013
Description: Biotinylated Human Dkk-1, Fc tag and Avi tag, is expressed in HEK 293 cells. (Uniprot ID: O94907-1)

Human DKK-3(Dickkopf-related protein 3) ELISA Kit

EH0114 96T
EUR 567.6
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 37.5pg/ml

Recombinant Dkk-3 Protein (Pro 23-Ile 349) [His]

VAng-1456Lsx-1mg 1 mg
EUR 5494
Description: Mouse Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_056629.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 349) [His]

VAng-1456Lsx-50g 50 µg
EUR 848
Description: Mouse Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_056629.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 350) [His]

VAng-1457Lsx-200g 200 µg
EUR 1123
Description: Human Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_001018067.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 350) [His]

VAng-1457Lsx-20g 20 µg
EUR 380
Description: Human Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_001018067.1)

Hemokinin 1 (human)

B5318-1 1 mg
EUR 340

Haptoglobin, (Phenotype 1-1) Human Plasma

7536-1
EUR 321

Endothelin-1 (1-15), amide, human

A1111-1 1 mg
EUR 722
Description: Endothelins are 21-amino acid vasoconstricting peptides produced primarily in the endothelium and have a key role in vascular homeostasis.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-10ug 10ug
EUR 156
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-1mg 1mg
EUR 2283
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-500ug 500ug
EUR 1613
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-50ug 50ug
EUR 369
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

BNP (1-32), human

A1105-1 1 mg
EUR 177
Description: Basic natriuretic peptide (BNP), now known as B-type natriuretic peptide (also BNP) or GC-B, is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).

IGF-1, human recombinant

P1016-.1 100 µg
EUR 763
Description: Insulin-like growth factor I (IGF-1) is a polypeptide endocrine hormone structurally similar to insulin and is mainly produced in the liver when stimulated by growth hormone. IGF-1 is a growth factor that stimulates the proliferation of various cell types including muscle, bone, and cartilage tissue

Neuregulin/Heregulin-1? (NRG-1?/HRG-1?), human recombinant protein

P1054-1 1 mg
EUR 3947
Description: Neuregulin (NRG) is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells and plays an important role in heart structure and function through inducing cardiomyocyte differentiation

IL1RL1 Human, Interleukin-1 Receptor Like-1 Human Recombinant Protein, Sf9

PROTQ01638-1 Regular: 10ug
EUR 317
Description: IL 1RL1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (19-328 a.a.) and fused to an 8 aa His Tag at C-terminus containing a total of 318 amino acids and having a molecular mass of 36.0kDa.;IL 1RL1 shows multiple bands between 40-57kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques.

MMP-1 Matrix Metalloproteinase-1 Human Recombinant Protein

PROTP03956-1 Regular: 20ug
EUR 317
Description: MMP 1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 393 amino acids (100-469a.a) and having a molecular mass of 45kDa. MMP 1 is fused to a 23 amino acid His-tag at N-terminus.

PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9

PROTP11464-1 Regular: 10ug
EUR 317
Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques.

ORM1 Orosomucoid 1 Human protein

PROTP02763-1 Regular: 10ug
EUR 317
Description: The Human Orosomucoid 1 produced from Human pooled serum has a molecular mass of 21.56kDa (calculated without glycosylation) containing 183 amino acid residues.

Recombinant Human Galectin-1 Protein

PROTP09382-1 50ug
EUR 317
Description: Lectins, of either plant or animal origin, are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with β-galactoside moieties. Galectin-1 is an animal lectin that has been shown to interact with CD3, CD4, and CD45. It induces apoptosis of activated T-cells and T-leukemia cell lines and inhibits the protein phosphatase activity of CD45. Recombinant human Galectin-1 is a 14.5 kDa protein containing 134 amino acid residues.

Recombinant Human Gremlin-1 Protein

PROTO60565-1 50ug
EUR 317
Description: Gremlin-1 (isoform-1) belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-β ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Gremlin is highly expressed in the small intestine, fetal brain, and colon and lower expression in brain, prostate, pancreas and skeletal muscle.  Gremlin-1 regulates multiple functions in early development by specifically binding to and inhibiting the function of BMP-2, -4, and -7.  It also plays a role in carcinogenesis and kidney branching morphogenesis. Recombinant Gremlin-1 is a 18.3  kDa protein containing 160 amino acid residues.

Parathyroid hormone (1-34) (human)

A1129-1 1 mg
EUR 166
Description: Parathyroid hormone (1-34) (human), (C181H291N55O51S2), a peptide with the sequence H2N-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH, MW= 4117.72.

Recombinant Human PECAM-1 Protein

PROTP16284-1 50ug
EUR 317
Description: PECAM is transmembrane glycoprotein that belongs to the Ig-related superfamily of adhesion molecules. It is highly expressed at endothelial cell junctions, and also expressed in platelets and in most leukocyte sub-types. The primary function of PECAM-1 is the mediation of leukocyte-endothelial cell adhesion and signal transduction. PECAM-1 has been implicated in the pathogenesis of various inflammation related disorders, including thrombosis, multiple sclerosis (MS), and rheumatoid arthritis. The human PECAM-1 gene codes for a 738 amino acid transmembrane glycoprotein containing a 118 amino acid cytoplasmic domain, a 19 amino acid transmembrane domain, and a 574 amino acid extracellular domain. Recombinant human PECAM-1 is a 572 amino acid glycoprotein comprising the extracellular domain of PECAM-1. Monomeric glycosylated PECAM-1 migrates at an apparent molecular weight of approximately 80.0-95.0 kDa by SDS-PAGE analysis under reducing conditions

Recombinant Human ANG-1 Protein

PROTQ15389-1 20ug
EUR 317
Description: Angiopoietin-1 (Ang-1) is a secreted ligand for Tie-2, a tyrosine-kinase receptor expressed primarily on vascular endothelial cells and early hematopoietic cells. Ang-1/ Tie-2 signaling promotes angiogenesis during the development, remodeling, and repair of the vascular system. Transgenic mice lacking expression of either Ang-1 or Tie-2 fail to develop a fully functional cardiovascular system and die before birth. Postnatally, the angiogenic activity of Ang-1/Tie-2 is required during normal tissue repair and remodeling of the female endometrium in the menstrual cycle. Ang-1/Tie-2 signaling appears to be regulated by Angiopoietin-2 (Ang-2), a natural antagonist for Tie-2 that exerts its effects through an internal autocrine loop mechanism. In addition to suppressing endothelial cell activation by inhibiting the expression of adhesion and inflammatory molecules, Ang-1 enhances endothelial cell survival and capillary morphogenesis, and lessens capillary permeability. As such, Ang-1 has a potential to become an effective therapeutic agent for treating various endothelium disorders, including several severe human pulmonary diseases. The efficacy of cell-based Ang-1 gene therapy for acute lung injury (ALI) has recently been studied in a rat model of ALI (1). The results of this study show that such therapy can markedly improve lung condition and suggest that Ang-1 therapy may represent a potential new strategy for the treatment and/or prevention of acute respiratory distress injury (ARDI), a significant cause of morbidity and mortality in critically ill patients. Recombinant human ANG-1, derived from HeLa cells, is a C-terminal histidine tagged glycoprotein which migrates with an apparent molecular mass of 60.0 – 70.0 kDa by SDS-PAGE under reducing conditions. Sequencing analysis shows N-terminal sequences starting with Ser-20 and with Asp-70 of the 498 amino acid precursor protein.

Amyloid ?-Peptide (1-42) (human)

B6057-.1 100 ug
EUR 276

ApoA-1, human recombinant protein

P1052-.1 100 µg
EUR 313
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.

ApoA-1, human recombinant protein

P1052-1 1 mg
EUR 1553
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.

WNT-1, human recombinant protein

P1068-1 1 mg
EUR 6940
Description: The WNT gene family compose of structurally related genes that encode secreted signaling proteins. These proteins have been involved in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.

(1-328) RAD51D (1-328 a.a.) Human Recombinant Protein

PROTO75771-1 Regular: 10ug
EUR 317
Description: RAD51D (1-328) Human Recombinant produced in E. coli is. a single polypeptide chain containing 351 amino acids and having a molecular mass of 37.4kDa. RAD51D (1-328) is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

NXPH1 Human, Neurexophilin 1 Human Recombinant Protein, Sf9

PROTP58417-1 Regular: 10ug
EUR 317
Description: NXPH1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 259 amino acids (22-271) and having a molecular mass of 29.7kDa (Molecular size on SDS-PAGE will appear at approximately 28-40kDa).;NXPH1 is fused to 9 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques.

TGF-b-1 Transforming Growth Factor-beta 1 Human protein

PROTP01137-1 Regular: 2.5ug
EUR 1157
Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques.

Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EI2200-1 96 Well Plate
EUR 477

Human Interleukin-1-alpha (IL-1-alpha) AssayMax ELISA Kit

EI2301-1 96 Well Plate
EUR 477

Human KRAB-associated Protein 1 (KAP-1) AssayMax ELISA Kit

EK2802-1 96 Well Plate
EUR 477

Human Plasminogen Activator Inhibitor-1 (PAI-1) AssayMax ELISA Kit

EP1100-1 96 Well Plate
EUR 417

MCP-1 Monocyte Chemotactic Protein-1 Human Recombinant Protein (CCL2)

PROTP13500-1 Regular: 20ug
EUR 317
Description: Monocyte Chemotactic Protein-1 Human Recombinant also known as Monocyte Chemotactic and Activating Factor (MCAF) produced in E.Coli is a non-glycosylated, Polypeptide chain containing 76 amino acids and having a molecular mass of 8.6kDa. ;The MCP-1 is purified by proprietary chromatographic techniques.

GAD1 iso1 Glutamate Decarboxylase 1 Isoform-1 Human Recombinant Protein

PROTQ99259-1 Regular: 20ug
EUR 317
Description: GAD1 iso1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 617 amino acids (1-594 a.a) and having a molecular mass of 69.3kDa. GAD1 iso1 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

Nesfatin-1 (human)

SP-100054-1 1 mg
EUR 773

OryzaExp? IGF-1 LR3, Human Recombinant

P1399-1
EUR 881

Recombinant Human sTRAIL Receptor-1 Protein

PROTO00220-1 50ug
EUR 317
Description: TRAIL Receptor-1/DR4 and TRAIL Receptor-2/DR5 belong to the TNFR superfamily of transmembrane proteins and contain a cytoplasmic "death domain, " which can activate the cell's apoptotic machinery. These receptors are activated by binding to either membrane anchored or soluble TRAIL/Apo2L. Recombinant human soluble TRAIL Receptor-1/DR4 is a 22.7 kDa protein (215 amino acid residues) consisting of the TNFR homologous, cysteine rich portion of the extracellular domain.

NNT1 Neurotrophin-1 Human Recombinant Protein

PROTQ9UBD9-1 Regular: 10ug
EUR 317
Description: Neurotrophin-1 Human Recombinant (28-225) produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 199 amino acids and having a molecular mass of 22kDa.;The NNT-1 is purified by proprietary chromatographic techniques.

HPSE Heparanase-1 Human Recombinant Protein

PROTQ9Y251-1 Regular: 20ug
EUR 317
Description: HPSE Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 531 amino acids (36-543 a.a) and having a molecular mass of 60kDa.;HPSE is fused to a 23 amino acid His-tag at N-terminus.

Human Glutaredoxin-1 AssayMax ELISA Kit

EG2153-1 96 Well Plate
EUR 417

Human Hexokinase-1 AssayMax ELISA Kit

EH3101-1 96 Well Plate
EUR 477

Human Complexin-1 AssayMax ELISA Kit

EC3505-1 96 Well Plate
EUR 417

Ac-Endothelin-1 (16-21), human

A1016-1 1 mg
EUR 84
Description: ENDOTHELIN-1 (ET-1), the principal peptide of the endothelin family, has been shown to have a variety of biological activities in both vascular and nonvascular tissues, including the heart, the kidney, and the central nervous system.

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Recombinant Human LAG-1 (CCL4L1) Protein

PROTP13236-1 20ug
EUR 317
Description: LAG-1 is CC chemokine that signals through the CCR5 receptor. LAG-1 is identical to MIP-1β (ACT II isotype) except for two amino acid substitutions; arginine for histidine at position 22 and serine for glycine at position 47 of the mature protein. LAG-1 chemoattracts monocytes, and exhibits activity as an HIV suppressive factor. Recombinant human LAG-1 is a 7.7 kDa protein containing 69 amino acid residues.

SDC1 Syndecan-1 Human Recombinant Protein

PROTP18827-1 Regular: 20ug
EUR 317
Description: SDC1 Human Recombinant produced in E. coli is a single polypeptide chain containing 262 amino acids (18-254) and having a molecular mass of 27kDa (molecular size on SDS-PAGE will appear higher).;SDC1 is fused to a 25 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

Recombinant Human Heregulin Beta -1 Protein

PROTQ02297-1 50ug
EUR 317
Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues).

 

Synthetic Biosystem for Modulation of Interactions between Antigen-Presenting Cells and T Cells

 

T cell activation is triggered by sign molecules on the floor of antigen-presenting cells (APC) and subsequent exertion of mobile forces. Deciphering the biomechanical and biochemical indicators on this complicated course of is of curiosity and can contribute to an enchancment in immunotherapy methods.

To deal with underlying questions, coculture and biomimetic fashions are established. Mature dendritic cells (mDC) are first handled with cytochalasin B (CytoB), a cytoskeletal disruption agent recognized to decrease obvious mobile stiffness and discount in T cell proliferation is noticed.

It’s tried to mimic mDC and T cell interactions utilizing polyacrylamide (PA) gels with outlined stiffness equivalent to mDC (0.2-25 kPa). Totally different ratios of anti-CD3 (aCD3) and anti-CD28 (aCD28) antibodies are immobilized onto PA gels. The outcomes present T cell proliferation is triggered by each aCD3 and aCD28 in a stiffness-dependent method.

Cells cultured on aCD3 immobilized on gels has considerably enhanced proliferation and IL-2 secretion, in comparison with aCD28. Moreover, ZAP70 phosphorylation is enhanced in stiffer substrate a in a aCD3-dependent method.

The biosystem supplies an method to review the discount of T cell proliferation noticed on CytoB-treated mDC. Total, the biosystem permits distinguishing the affect of biophysical and biochemical indicators of APC and T cell interactions in vitro.

 

Graphene-based nanomaterials in biosystems.

 

Graphene-based nanomaterials have emerged as a novel kind of supplies with distinctive physicochemical properties and quite a few purposes in numerous areas.

 

On this overview, we summarize latest advances in finding out interactions between graphene and biosystems. We first present a quick introduction on graphene and its derivatives, after which focus on on the toxicology and biocompatibility of graphene, together with the extracellular interactions between graphene and biomacromolecules, mobile research of graphene, and in vivo toxicological results.

 

Subsequent, we deal with numerous graphene-based sensible purposes in antibacterial supplies, wound addressing, drug supply, and water purification. We lastly current views on challenges and future developments in these thrilling fields.

 

Preface: Management and Design of Biosystems.

 

Biosystems are dynamic networks pushed by cross-scale interactions between molecules, cells, tissues, organs and organisms. Latest advances in our understanding of the spatiotemporal regulation and group of biosystems have stimulated exploration of novel approaches to manage and design biosystems at a number of organic scales.

Such new approaches embody synthetic cell synthesis, era of embryoids/organoids, reconstitution and manipulation of life occasions akin to growing old and copy, and multidisciplinary approaches utilizing theoretical and engineering applied sciences.

These control-and-design methodologies are anticipated to open up a brand new avenue to understanding life occasions in addition to to supply the idea for novel design methods in medical sciences.

KIR2DL4 Blocking Peptide

33R-9831 100 ug
EUR 180
Description: A synthetic peptide for use as a blocking control in assays to test for specificity of KIR2DL4 antibody, catalog no. 70R-2365

pOTB7-KIR2DL4 Plasmid

PVTB00348 2 ug
EUR 356

KIR2DL4 cloning plasmid

CSB-CL857457HU-10ug 10ug
EUR 233
Description: A cloning plasmid for the KIR2DL4 gene.

KIR2DL4 Rabbit pAb

A12836-100ul 100 ul
EUR 308

KIR2DL4 Rabbit pAb

A12836-200ul 200 ul
EUR 459

KIR2DL4 Rabbit pAb

A12836-20ul 20 ul
EUR 183

KIR2DL4 Rabbit pAb

A12836-50ul 50 ul
EUR 223

KIR2DL4 Polyclonal Antibody

27806-100ul 100ul
EUR 252

KIR2DL4 Polyclonal Antibody

27806-50ul 50ul
EUR 187

KIR2DL4 ORF Vector (Human) (pORF)

ORF005681 1.0 ug DNA
EUR 95

pEGFP-flag-KIR2DL4 Plasmid

PVTB00348-2a 2 ug
EUR 356

KIR2DL4 Polyclonal Conjugated Antibody

C27806 100ul
EUR 397

KIR2DL4 sgRNA CRISPR Lentivector set (Human)

K1150301 3 x 1.0 ug
EUR 339

Polyclonal Goat anti-GST α-form

GST-ANTI-1 50 uL
EUR 280

Polyclonal Goat anti-GST μ-form

GST-ANTI-2 50 uL
EUR 280

Polyclonal Goat anti-GST p-form

GST-ANTI-3 50 uL
EUR 280

KIR2DL3/KIR2DL1/KIR2DL4/KIR2DS4 Antibody

1-CSB-PA205578
  • EUR 317.00
  • EUR 244.00
  • 100ul
  • 50ul
Description: A polyclonal antibody against KIR2DL3/KIR2DL1/KIR2DL4/KIR2DS4. Recognizes KIR2DL3/KIR2DL1/KIR2DL4/KIR2DS4 from Human. This antibody is Unconjugated. Tested in the following application: ELISA, IHC;ELISA:1:2000-1:5000, IHC:1:50-1:200

KIR2DL3/KIR2DL1/KIR2DL4/KIR2DS4 Antibody

1-CSB-PA246816
  • EUR 317.00
  • EUR 244.00
  • 100ul
  • 50ul
Description: A polyclonal antibody against KIR2DL3/KIR2DL1/KIR2DL4/KIR2DS4. Recognizes KIR2DL3/KIR2DL1/KIR2DL4/KIR2DS4 from Human. This antibody is Unconjugated. Tested in the following application: ELISA, IHC;ELISA:1:1000-1:2000, IHC:1:50-1:100

KIR2DL3 / KIR2DL1 / KIR2DL4 / KIR2DS4 Antibody

20-abx339417
  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul

KIR2DL3 / KIR2DL1 / KIR2DL4 / KIR2DS4 Antibody

20-abx210854
  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul

Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His)

C310-10ug 10ug
EUR 131
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His)

C310-1mg 1mg
EUR 2283
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His)

C310-500ug 500ug
EUR 1613
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His)

C310-50ug 50ug
EUR 273
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

KIR2DL4 Protein Vector (Human) (pPB-C-His)

PV022721 500 ng
EUR 329

KIR2DL4 Protein Vector (Human) (pPB-N-His)

PV022722 500 ng
EUR 329

KIR2DL4 Protein Vector (Human) (pPM-C-HA)

PV022723 500 ng
EUR 329

KIR2DL4 Protein Vector (Human) (pPM-C-His)

PV022724 500 ng
EUR 329

Recombinant Human KIR2DL4 Protein, His, Insect-1ug

QP12489-1ug 1ug
EUR 155

Recombinant Human KIR2DL4 Protein, His, Insect-50ug

QP12489-50ug 50ug
EUR 1261

Recombinant Human KIR2DL4 Protein, His, Insect-5ug

QP12489-5ug 5ug
EUR 201

KIR2DL4 sgRNA CRISPR Lentivector (Human) (Target 1)

K1150302 1.0 ug DNA
EUR 154

KIR2DL4 sgRNA CRISPR Lentivector (Human) (Target 2)

K1150303 1.0 ug DNA
EUR 154

KIR2DL4 sgRNA CRISPR Lentivector (Human) (Target 3)

K1150304 1.0 ug DNA
EUR 154

KIR2DL4 3'UTR Luciferase Stable Cell Line

TU011796 1.0 ml
EUR 1521

KIR2DL4 3'UTR GFP Stable Cell Line

TU061796 1.0 ml
EUR 1521

KIR2DL4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

K1150305 3 x 1.0 ug
EUR 376

Killer Cell Immunoglobulin-Like Receptor 2DL4 (KIR2DL4) Antibody

abx145740-100ug 100 ug
EUR 391

KIR2DL4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

K1150306 1.0 ug DNA
EUR 167

KIR2DL4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

K1150307 1.0 ug DNA
EUR 167

KIR2DL4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

K1150308 1.0 ug DNA
EUR 167

KIR2DL4 Killer Cell Immunoglobulin-Like Receptor, 2 Domains Long Cytoplasmic Tail 4 Human Recombinant Protein

PROTQ99706 Regular: 5ug
EUR 317
Description: KIR2DL4 Human Recombinant produced in Sf9 Insect cells is a single, glycosylated polypeptide chain containing 458 amino acids (24-242 a.a.) and having a molecular mass of 51kDa (Molecular size on SDS-PAGE will appear at approximately 50-70kDa). KIR2DL4 is expressed with a 239 amino acids hIgG-His tag at C-Terminus and purified by proprietary chromatographic techniques. 

anti-human CCR1

20R-3028 200 ug
EUR 587
Description: Goat anti-human CCR1 antibody

anti-human RecQL4

AR05-PA0007 100 ul
EUR 334
Description: Rabbit polyclonal to human RecQL4

Anti-Human IgG

DB-173-0.1 100 μl
EUR 212
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-173-0.2 200 μl
EUR 298
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-173-0.5 500 μl
EUR 384
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-173-1 1 ml
EUR 613
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-173-RTU-15 15 ml
EUR 355
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB-173-RTU-7 7 ml
EUR 231
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB-174-0.1 100 μl
EUR 212
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-174-0.2 200 μl
EUR 298
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-174-0.5 500 μl
EUR 384
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-174-1 1 ml
EUR 613
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Human IgG

DB-174-RTU-15 15 ml
EUR 355
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB-174-RTU-7 7 ml
EUR 231
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB173RTU-15 15 ml
EUR 355
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB173RTU-7 7 ml
EUR 231
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB174RTU-15 15 ml
EUR 355
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

Anti-Human IgG

DB174RTU-7 7 ml
EUR 231
Description: rabbit monospecific clonal antibodies for ihc-p application; prediluted (ready to use)

anti-human Albumin

LF-PA10001 100 ug
EUR 403
Description: Rabbit polyclonal to human Albumin

Anti-Procalcitonin antibody *Mouse anti-human, monoclonal *

V100125 50 ug
EUR 306

Anti-Procalcitonin antibody *Mouse anti-human, monoclonal *

V100126 1 mg
EUR 393

Goat anti-Human anti-thrombin polyclonal antibody

CABT-L487 500ug
EUR 715

Sheep anti-Human anti-thrombin polyclonal antibody

CABT-L488 500ug
EUR 663

Sheep anti-Human anti-thrombin polyclonal antibody

CABT-L489 100ug
EUR 663

Sheep anti-Human anti-thrombin polyclonal antibody

CABT-L490 100ug
EUR 663

Sheep anti-Human anti-thrombin polyclonal antibody

CABT-L491 100ug
EUR 663

Human anti AMPH(anti amphiphysin) ELISA Kit

EH2621 96T
EUR 524.1
Description: Method of detection: Sandwich ELISA, Double Antigen;Reacts with: Homo sapiens;Sensitivity: 18.75pg/ml

Human anti-TPO(anti-thrombopoietin) ELISA Kit

EH4147 96T
EUR 524.1
Description: Method of detection: Sandwich ELISA, Double Antigen;Reacts with: Homo sapiens ;Sensitivity: 0.938 ng/ml

Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) ELISA Kit

AEA465Hu-10x96wellstestplate 10x96-wells test plate
EUR 5647.8
Description: This is Competitive Enzyme-linked immunosorbent assay for Antibody Detection.detection of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) in serum, plasma and other biological fluids.

Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) ELISA Kit

AEA465Hu-1x48wellstestplate 1x48-wells test plate
EUR 552.76
Description: This is Competitive Enzyme-linked immunosorbent assay for Antibody Detection.detection of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) in serum, plasma and other biological fluids.

Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) ELISA Kit

AEA465Hu-1x96wellstestplate 1x96-wells test plate
EUR 746.8
Description: This is Competitive Enzyme-linked immunosorbent assay for Antibody Detection.detection of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) in serum, plasma and other biological fluids.

Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) ELISA Kit

AEA465Hu-5x96wellstestplate 5x96-wells test plate
EUR 3060.6
Description: This is Competitive Enzyme-linked immunosorbent assay for Antibody Detection.detection of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) in serum, plasma and other biological fluids.

Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) ELISA Kit

4-AEA465Hu
  • EUR 5698.00
  • EUR 3011.00
  • EUR 747.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Human Anti-Anti-Sperm Antibody Antibody (Anti-AsAb) in samples from serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Goat anti Human IgE

70R-IG015 1 mg
EUR 349
Description: Affinity purified Goat anti Human IgE antibody

Anti-human CD9 antibody

A1500-50
EUR 465

Anti-human CD63 antibody

A1502-50
EUR 490

Anti-human CD41 antibody

A1503-50
EUR 468

Anti-human CD81 antibody

A1504-50
EUR 468

Anti-human CD44 antibody

A1505-50
EUR 468

Anti-human Alix Antibody

A1507-50
EUR 501

Anti-human TM9SF4 antibody

A1508-50
EUR 468

Anti-human Flotillin antibody

A1510-50
EUR 501

Anti-human Rab5 antibody

A1511-50
EUR 465

Anti-human TM9SF4 antibody

A1514-50
EUR 446

anti-Human Growth Hormone

YF-PA12007 50 ug
EUR 363
Description: Mouse polyclonal to Human Growth Hormone

anti-Human Growth Hormone

YF-PA12008 100 ul
EUR 403
Description: Rabbit polyclonal to Human Growth Hormone

anti-Human Growth Hormone

YF-PA12009 100 ug
EUR 403
Description: Rabbit polyclonal to Human Growth Hormone

Sheep anti Human IgA

20C-CR6043SP 1 ml
EUR 221
Description: Sheep anti Human IgA antibody

Sheep anti Human IgA

20C-CR6043SP-S 1 ml
EUR 221
Description: Sheep anti Human IgA antibody

Goat anti Human IgM

70-B9022GA00-A0 5 mg
EUR 192
Description: Goat anti Human IgM antibody
oxfordpcs
oxfordpcs

Leave a Reply

Your email address will not be published.